SCOP 1.73: Domain d2fb3b1: 2fb3 B:4-329

Lineage for d2fb3b1 (2fb3 B:4-329)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.28: Radical SAM enzymes [102114] (3 families)
   common Fe-S cluster and SAM binding sites are embedded into complete or incomplete beta/alpha-barrel

5. Family c.1.28.3: MoCo biosynthesis proteins [110388] (1 protein)
   open alpha/beta-barrel with a specific second FeS cluster-binding region corresponding to Pfam PF06463

6. Protein Molybdenum cofactor biosynthesis protein A MoaA [110389] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [110390] (3 PDB entries)

8. Domain d2fb3b1: 2fb3 B:4-329 [133234]
   automatically matched to d1tv7a_
   complexed with 5ad, gtp, met, pop, sf4, so4

Details for d2fb3b1

PDB Entry: 2fb3, 2.35 Å

PDB Description: Structure of MoaA in complex with 5'-GTP

PDB Compounds: (B:) Molybdenum cofactor biosynthesis protein A

SCOP Domain Sequences for d2fb3b1:

Sequence; same for both SEQRES and ATOM records:

>d2fb3b1 c.1.28.3 (B:4-329) Molybdenum cofactor biosynthesis protein A MoaA {Staphylococcus aureus [TaxId: 1280]}
qikdklgrpirdlrlsvtdrcnfrcdycmpkevfgddfvflpknelltfdemariakvya
elgvkkiritggeplmrrdldvliaklnqidgiediglttnglllkkhgqklydaglrri
nvsldaiddtlfqsinnrnikattileqidyatsiglnvkvnvviqkginddqiipmley
fkdkhieirfiefmdvgndngwdfskvvtkdemltmieqhfeidpvepkyfgevakyyrh
kdngvqfglitsvsqsfcstctrarlssdgkfygclfatvdgfnvkafirsgvtdeelke
qfkalwqirddrysdertaqtvanrq

Timeline for d2fb3b1:

• d2fb3b1 is new in SCOP 1.73
  
• d2fb3b1 appears in SCOP 1.75
  
• d2fb3b1 appears in the current release, SCOPe 2.08, called d2fb3b_