![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.68: Nudix-associated domain [140299] (2 proteins) PfamB PB002148; this domain is C-terminal to the Nudix domain in some bacterial proteins |
![]() | Protein Hypothetical protein BT0354, C-terminal domain [140300] (1 species) |
![]() | Species Bacteroides thetaiotaomicron [TaxId:818] [140301] (1 PDB entry) Uniprot Q8AAV8 150-225 |
![]() | Domain d2fb1c1: 2fb1 C:150-225 [133229] Other proteins in same PDB: d2fb1a2, d2fb1b2, d2fb1c2, d2fb1d2 automated match to d2fb1a1 complexed with po4 |
PDB Entry: 2fb1 (more details), 2.5 Å
SCOPe Domain Sequences for d2fb1c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fb1c1 a.4.5.68 (C:150-225) Hypothetical protein BT0354, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} pigfnllpklftlsqlqslyeaiygepmdkrnfrkrvaemdfiektdkidklgskrgaal ykfngkayrkdpkfkl
Timeline for d2fb1c1: