Lineage for d2fb1c1 (2fb1 C:150-225)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634918Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) (S)
    contains a small beta-sheet (wing)
  5. 635917Family a.4.5.68: Nudix-associated domain [140299] (2 proteins)
    PfamB 002148; this domain is C-terminal to the Nudix domain in some bacterial proteins
  6. 635918Protein Hypothetical protein BT0354, C-terminal domain [140300] (1 species)
  7. 635919Species Bacteroides thetaiotaomicron [TaxId:818] [140301] (1 PDB entry)
  8. 635922Domain d2fb1c1: 2fb1 C:150-225 [133229]
    Other proteins in same PDB: d2fb1a2, d2fb1b2, d2fb1c2, d2fb1d2
    automatically matched to 2FB1 A:150-225
    complexed with po4

Details for d2fb1c1

PDB Entry: 2fb1 (more details), 2.5 Å

PDB Description: crystal structure of protein bt0354 from bacteroides thetaiotaomicron
PDB Compounds: (C:) conserved hypothetical protein

SCOP Domain Sequences for d2fb1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fb1c1 a.4.5.68 (C:150-225) Hypothetical protein BT0354, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
pigfnllpklftlsqlqslyeaiygepmdkrnfrkrvaemdfiektdkidklgskrgaal
ykfngkayrkdpkfkl

SCOP Domain Coordinates for d2fb1c1:

Click to download the PDB-style file with coordinates for d2fb1c1.
(The format of our PDB-style files is described here.)

Timeline for d2fb1c1: