SCOPe 2.04: Domain d2fb1b1: 2fb1 B:150-225

Lineage for d2fb1b1 (2fb1 B:150-225)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.68: Nudix-associated domain [140299] (2 proteins)
   PfamB PB002148; this domain is C-terminal to the Nudix domain in some bacterial proteins

6. Protein Hypothetical protein BT0354, C-terminal domain [140300] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [140301] (1 PDB entry)
   Uniprot Q8AAV8 150-225

8. Domain d2fb1b1: 2fb1 B:150-225 [133227]
   Other proteins in same PDB: d2fb1a2, d2fb1b2, d2fb1c2, d2fb1d2
   automated match to d2fb1a1
   complexed with po4

Details for d2fb1b1

PDB Entry: 2fb1, 2.5 Å

PDB Description: crystal structure of protein bt0354 from bacteroides thetaiotaomicron

PDB Compounds: (B:) conserved hypothetical protein

SCOPe Domain Sequences for d2fb1b1:

Sequence, based on SEQRES records:

>d2fb1b1 a.4.5.68 (B:150-225) Hypothetical protein BT0354, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
pigfnllpklftlsqlqslyeaiygepmdkrnfrkrvaemdfiektdkidklgskrgaal
ykfngkayrkdpkfkl

Sequence, based on observed residues (ATOM records):

>d2fb1b1 a.4.5.68 (B:150-225) Hypothetical protein BT0354, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
pigfnllpklftlsqlqslyeaiygepmdkrnfrkrvaemdfiektdkidklgskrgaal
ykfngkayrkdpfkl

Timeline for d2fb1b1:

• d2fb1b1 first appeared in SCOP 1.73
  
• d2fb1b1 appears in SCOPe 2.03
  
• d2fb1b1 last appears in SCOPe 2.05