SCOPe 2.05: Domain d2fb1a2: 2fb1 A:3-149

Lineage for d2fb1a2 (2fb1 A:3-149)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.6: BT0354 N-terminal domain-like [143772] (3 proteins)
   accosiated with the C-terminal "winged helix" domain (46785)

6. Protein Hypothetical protein BT0354, N-terminal domain [143775] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [143776] (1 PDB entry)
   Uniprot Q8AAV8 3-149

8. Domain d2fb1a2: 2fb1 A:3-149 [133226]
   Other proteins in same PDB: d2fb1a1, d2fb1b1, d2fb1c1, d2fb1d1
   complexed with po4

Details for d2fb1a2

PDB Entry: 2fb1, 2.5 Å

PDB Description: crystal structure of protein bt0354 from bacteroides thetaiotaomicron

PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d2fb1a2:

Sequence; same for both SEQRES and ATOM records:

>d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
nyyssnptfylgidciifgfnegeisllllkrnfepamgewslmggfvqkdesvddaakr
vlaeltglenvymeqvgafgaidrdpgervvsiayyalinineydrelvqkhnaywvnin
elpalifdhpemvdkaremmkqkasve

Timeline for d2fb1a2:

• d2fb1a2 first appeared in SCOP 1.73
  
• d2fb1a2 appears in SCOPe 2.04
  
• d2fb1a2 does not appear in SCOPe 2.06