Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) |
Family d.113.1.6: BT0354 N-terminal domain-like [143772] (3 proteins) accosiated with the C-terminal "winged helix" domain (46785) |
Protein Hypothetical protein BT0354, N-terminal domain [143775] (1 species) |
Species Bacteroides thetaiotaomicron [TaxId:818] [143776] (1 PDB entry) Uniprot Q8AAV8 3-149 |
Domain d2fb1a2: 2fb1 A:3-149 [133226] Other proteins in same PDB: d2fb1a1, d2fb1b1, d2fb1c1, d2fb1d1 complexed with po4 |
PDB Entry: 2fb1 (more details), 2.5 Å
SCOPe Domain Sequences for d2fb1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} nyyssnptfylgidciifgfnegeisllllkrnfepamgewslmggfvqkdesvddaakr vlaeltglenvymeqvgafgaidrdpgervvsiayyalinineydrelvqkhnaywvnin elpalifdhpemvdkaremmkqkasve
Timeline for d2fb1a2: