Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) contains a small beta-sheet (wing) |
Family a.4.5.68: Nudix-associated domain [140299] (2 proteins) PfamB PB002148; this domain is C-terminal to the Nudix domain in some bacterial proteins |
Protein Hypothetical protein BT0354, C-terminal domain [140300] (1 species) |
Species Bacteroides thetaiotaomicron [TaxId:818] [140301] (1 PDB entry) Uniprot Q8AAV8 150-225 |
Domain d2fb1a1: 2fb1 A:150-225 [133225] Other proteins in same PDB: d2fb1a2, d2fb1b2, d2fb1c2, d2fb1d2 complexed with po4 |
PDB Entry: 2fb1 (more details), 2.5 Å
SCOP Domain Sequences for d2fb1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fb1a1 a.4.5.68 (A:150-225) Hypothetical protein BT0354, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} pigfnllpklftlsqlqslyeaiygepmdkrnfrkrvaemdfiektdkidklgskrgaal ykfngkayrkdpkfkl
Timeline for d2fb1a1: