SCOPe 2.01: Domain d2fazb_: 2faz B:

Lineage for d2fazb_ (2faz B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (3 PDB entries)

8. Domain d2fazb_: 2faz B: [133224]
   Other proteins in same PDB: d2faza1
   automated match to d1c3ta_

Details for d2fazb_

PDB Entry: 2faz, 2 Å

PDB Description: Ubiquitin-Like Domain of Human Nuclear Zinc Finger Protein NP95

PDB Compounds: (B:) Ubiquitin-like containing PHD and RING finger domains protein 1

SCOPe Domain Sequences for d2fazb_:

Sequence; same for both SEQRES and ATOM records:

>d2fazb_ d.15.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsmwiqvrtmdgrqthtvdslsrltkveelrrkiqelfhvepglqrlfyrgkqmedghtl
fdyevrlndtiqll

Timeline for d2fazb_:

• d2fazb_ first appeared in SCOP 1.73, called d2fazb1
  
• d2fazb_ was called d2fazb1 in SCOP 1.75
  
• d2fazb_ appears in SCOPe 2.02
  
• d2fazb_ appears in the current release, SCOPe 2.08, called d2fazb2