Lineage for d2fazb2 (2faz B:1-72)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933161Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries)
  8. 2933238Domain d2fazb2: 2faz B:1-72 [133224]
    Other proteins in same PDB: d2faza1, d2faza2, d2fazb3
    automated match to d1c3ta_

Details for d2fazb2

PDB Entry: 2faz (more details), 2 Å

PDB Description: Ubiquitin-Like Domain of Human Nuclear Zinc Finger Protein NP95
PDB Compounds: (B:) Ubiquitin-like containing PHD and RING finger domains protein 1

SCOPe Domain Sequences for d2fazb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fazb2 d.15.1.0 (B:1-72) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mwiqvrtmdgrqthtvdslsrltkveelrrkiqelfhvepglqrlfyrgkqmedghtlfd
yevrlndtiqll

SCOPe Domain Coordinates for d2fazb2:

Click to download the PDB-style file with coordinates for d2fazb2.
(The format of our PDB-style files is described here.)

Timeline for d2fazb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fazb3