![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
![]() | Protein automated matches [190233] (31 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries) |
![]() | Domain d2fazb2: 2faz B:1-72 [133224] Other proteins in same PDB: d2faza1, d2faza2, d2fazb3 automated match to d1c3ta_ |
PDB Entry: 2faz (more details), 2 Å
SCOPe Domain Sequences for d2fazb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fazb2 d.15.1.0 (B:1-72) automated matches {Human (Homo sapiens) [TaxId: 9606]} mwiqvrtmdgrqthtvdslsrltkveelrrkiqelfhvepglqrlfyrgkqmedghtlfd yevrlndtiqll
Timeline for d2fazb2: