Lineage for d2faza1 (2faz A:1-76)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2538336Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2539502Protein Ubiquitin-like PHD and RING finger domain-containing protein 1 [142948] (1 species)
  7. 2539503Species Human (Homo sapiens) [TaxId:9606] [142949] (1 PDB entry)
    Uniprot Q96T88 1-76
  8. 2539504Domain d2faza1: 2faz A:1-76 [133223]
    Other proteins in same PDB: d2faza2, d2fazb2, d2fazb3

Details for d2faza1

PDB Entry: 2faz (more details), 2 Å

PDB Description: Ubiquitin-Like Domain of Human Nuclear Zinc Finger Protein NP95
PDB Compounds: (A:) Ubiquitin-like containing PHD and RING finger domains protein 1

SCOPe Domain Sequences for d2faza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]}
mwiqvrtmdgrqthtvdslsrltkveelrrkiqelfhvepglqrlfyrgkqmedghtlfd
yevrlndtiqllvrqs

SCOPe Domain Coordinates for d2faza1:

Click to download the PDB-style file with coordinates for d2faza1.
(The format of our PDB-style files is described here.)

Timeline for d2faza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2faza2