![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein Ubiquitin-like PHD and RING finger domain-containing protein 1 [142948] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142949] (1 PDB entry) Uniprot Q96T88 1-76 |
![]() | Domain d2faza1: 2faz A:1-76 [133223] Other proteins in same PDB: d2faza2, d2fazb2, d2fazb3 |
PDB Entry: 2faz (more details), 2 Å
SCOPe Domain Sequences for d2faza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} mwiqvrtmdgrqthtvdslsrltkveelrrkiqelfhvepglqrlfyrgkqmedghtlfd yevrlndtiqllvrqs
Timeline for d2faza1: