Lineage for d2faza1 (2faz A:1-76)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717081Superfamily d.15.1: Ubiquitin-like [54236] (7 families) (S)
  5. 717082Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
    Pfam PF00240
  6. 717328Protein Ubiquitin-like PHD and RING finger domain-containing protein 1 [142948] (1 species)
  7. 717329Species Human (Homo sapiens) [TaxId:9606] [142949] (1 PDB entry)
  8. 717330Domain d2faza1: 2faz A:1-76 [133223]

Details for d2faza1

PDB Entry: 2faz (more details), 2 Å

PDB Description: Ubiquitin-Like Domain of Human Nuclear Zinc Finger Protein NP95
PDB Compounds: (A:) Ubiquitin-like containing PHD and RING finger domains protein 1

SCOP Domain Sequences for d2faza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]}
mwiqvrtmdgrqthtvdslsrltkveelrrkiqelfhvepglqrlfyrgkqmedghtlfd
yevrlndtiqllvrqs

SCOP Domain Coordinates for d2faza1:

Click to download the PDB-style file with coordinates for d2faza1.
(The format of our PDB-style files is described here.)

Timeline for d2faza1: