Lineage for d2fakz_ (2fak Z:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2990986Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2990995Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2991498Domain d2fakz_: 2fak Z: [133222]
    Other proteins in same PDB: d2faka_, d2fakb_, d2fakc_, d2fake_, d2fakf_, d2fakg_, d2fako_, d2fakp_, d2fakq_, d2faks_, d2fakt_, d2faku_
    automated match to d1g0ul_
    complexed with sa1

Details for d2fakz_

PDB Entry: 2fak (more details), 2.8 Å

PDB Description: Crystal structure of Salinosporamide A in complex with the yeast 20S proteasome
PDB Compounds: (Z:) Proteasome component C5

SCOPe Domain Sequences for d2fakz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fakz_ d.153.1.4 (Z:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd

SCOPe Domain Coordinates for d2fakz_:

Click to download the PDB-style file with coordinates for d2fakz_.
(The format of our PDB-style files is described here.)

Timeline for d2fakz_: