Lineage for d2fakm_ (2fak M:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2990986Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2990995Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2991491Domain d2fakm_: 2fak M: [133209]
    Other proteins in same PDB: d2faka_, d2fakb_, d2fakc_, d2fake_, d2fakf_, d2fakg_, d2fako_, d2fakp_, d2fakq_, d2faks_, d2fakt_, d2faku_
    automated match to d1g0u1_
    complexed with sa1

Details for d2fakm_

PDB Entry: 2fak (more details), 2.8 Å

PDB Description: Crystal structure of Salinosporamide A in complex with the yeast 20S proteasome
PDB Compounds: (M:) Proteasome component PRE4

SCOPe Domain Sequences for d2fakm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fakm_ d.153.1.4 (M:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki

SCOPe Domain Coordinates for d2fakm_:

Click to download the PDB-style file with coordinates for d2fakm_.
(The format of our PDB-style files is described here.)

Timeline for d2fakm_: