![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
![]() | Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins) |
![]() | Protein automated matches [190286] (9 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [187089] (2 PDB entries) |
![]() | Domain d2faeb_: 2fae B: [133194] automated match to d1acp__ complexed with pm8, pse, zn |
PDB Entry: 2fae (more details), 1.55 Å
SCOPe Domain Sequences for d2faeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2faeb_ a.28.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]} stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae kittvqaaidyinghqa
Timeline for d2faeb_: