SCOPe 2.03: Domain d2faea_: 2fae A:

Lineage for d2faea_ (2fae A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)

6. Protein automated matches [190286] (7 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187089] (2 PDB entries)

8. Domain d2faea_: 2fae A: [133193]
   automated match to d1acp__
   complexed with pm8, pse, zn

Details for d2faea_

PDB Entry: 2fae, 1.55 Å

PDB Description: Crystal structure of E. coli decanoyl-ACP

PDB Compounds: (A:) Acyl carrier protein

SCOPe Domain Sequences for d2faea_:

Sequence; same for both SEQRES and ATOM records:

>d2faea_ a.28.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
kittvqaaidyinghqa

Timeline for d2faea_:

• d2faea_ first appeared in SCOP 1.73, called d2faea1
  
• d2faea_ appears in SCOPe 2.02
  
• d2faea_ appears in SCOPe 2.04
  
• d2faea_ appears in the current release, SCOPe 2.08