Lineage for d2faea_ (2fae A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1266817Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1266818Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 1266819Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)
  6. 1266875Protein automated matches [190286] (7 species)
    not a true protein
  7. 1266888Species Escherichia coli [TaxId:562] [187089] (2 PDB entries)
  8. 1266889Domain d2faea_: 2fae A: [133193]
    automated match to d1acp__
    complexed with pm8, pse, zn

Details for d2faea_

PDB Entry: 2fae (more details), 1.55 Å

PDB Description: Crystal structure of E. coli decanoyl-ACP
PDB Compounds: (A:) Acyl carrier protein

SCOPe Domain Sequences for d2faea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2faea_ a.28.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
kittvqaaidyinghqa

SCOPe Domain Coordinates for d2faea_:

Click to download the PDB-style file with coordinates for d2faea_.
(The format of our PDB-style files is described here.)

Timeline for d2faea_: