Lineage for d2fadb_ (2fad B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706109Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2706110Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)
  6. 2706115Protein Acyl carrier protein [47338] (7 species)
  7. 2706121Species Escherichia coli [TaxId:562] [47339] (26 PDB entries)
    Uniprot P02901
  8. 2706125Domain d2fadb_: 2fad B: [133192]
    automated match to d1acp__
    complexed with na, pm5, zn

Details for d2fadb_

PDB Entry: 2fad (more details), 1.6 Å

PDB Description: Crystal structure of E. coli heptanoyl-ACP
PDB Compounds: (B:) Acyl carrier protein

SCOPe Domain Sequences for d2fadb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fadb_ a.28.1.1 (B:) Acyl carrier protein {Escherichia coli [TaxId: 562]}
stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
kittvqaaidyinghqa

SCOPe Domain Coordinates for d2fadb_:

Click to download the PDB-style file with coordinates for d2fadb_.
(The format of our PDB-style files is described here.)

Timeline for d2fadb_: