Class a: All alpha proteins [46456] (286 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) |
Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins) |
Protein Acyl carrier protein [47338] (6 species) |
Species Escherichia coli [TaxId:562] [47339] (14 PDB entries) Uniprot P02901 |
Domain d2fada_: 2fad A: [133191] automated match to d1acp__ complexed with na, pm5, zn |
PDB Entry: 2fad (more details), 1.6 Å
SCOPe Domain Sequences for d2fada_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fada_ a.28.1.1 (A:) Acyl carrier protein {Escherichia coli [TaxId: 562]} stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae kittvqaaidyinghqa
Timeline for d2fada_: