Class a: All alpha proteins [46456] (258 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (3 families) |
Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (5 proteins) |
Protein Acyl carrier protein [47338] (4 species) |
Species Escherichia coli [TaxId:562] [47339] (8 PDB entries) |
Domain d2fada1: 2fad A:1-76 [133191] automatically matched to d1acp__ complexed with na, pm5, zn |
PDB Entry: 2fad (more details), 1.6 Å
SCOP Domain Sequences for d2fada1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fada1 a.28.1.1 (A:1-76) Acyl carrier protein {Escherichia coli [TaxId: 562]} stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae kittvqaaidyinghq
Timeline for d2fada1: