SCOP 1.73: Domain d2fa8c1: 2fa8 C:4-83

Lineage for d2fa8c1 (2fa8 C:4-83)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (22 families)

5. Family c.47.1.23: Selenoprotein W-related [142411] (3 proteins)
   Pfam PF05169; "minimalized" version of the thioredoxin-like fold

6. Protein Hypothetical protein Atu0228 [142414] (1 species)

7. Species Agrobacterium tumefaciens [TaxId:358] [142415] (1 PDB entry)

8. Domain d2fa8c1: 2fa8 C:4-83 [133187]
   automatically matched to 2FA8 A:4-89

Details for d2fa8c1

PDB Entry: 2fa8, 1.9 Å

PDB Description: Crystal Structure of the Putative Selenoprotein W-related family Protein from Agrobacterium tumefaciens

PDB Compounds: (C:) hypothetical protein Atu0228

SCOP Domain Sequences for d2fa8c1:

Sequence; same for both SEQRES and ATOM records:

>d2fa8c1 c.47.1.23 (C:4-83) Hypothetical protein Atu0228 {Agrobacterium tumefaciens [TaxId: 358]}
tkpriairyctqcnwllragwmaqeilqtfasdigevslipstgglfeitvdgtiiwerk
rdggfpgpkelkqrirdlid

Timeline for d2fa8c1:

• d2fa8c1 is new in SCOP 1.73
  
• d2fa8c1 appears in SCOP 1.75
  
• d2fa8c1 appears in the current release, SCOPe 2.08, called d2fa8c_