![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.190: Chorismate lyase-like [64287] (1 superfamily) duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654 |
![]() | Superfamily d.190.1: Chorismate lyase-like [64288] (3 families) ![]() |
![]() | Family d.190.1.2: UTRA domain [143473] (10 proteins) Pfam PF07702 |
![]() | Protein Probable transcriptional regulator PhnF, receptor domain [143474] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [143475] (1 PDB entry) Uniprot P16684 84-241 |
![]() | Domain d2fa1a1: 2fa1 A:84-241 [133182] complexed with bdf |
PDB Entry: 2fa1 (more details), 1.7 Å
SCOP Domain Sequences for d2fa1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fa1a1 d.190.1.2 (A:84-241) Probable transcriptional regulator PhnF, receptor domain {Escherichia coli [TaxId: 562]} mnaqarfsqnlldqgshptsekllsvlrpasghvadalgitegenvihlrtlrrvngval clidhyfadltlwptlqrfdsgslhdflreqtgialrrsqtrisarraqakecqrleipn mspllcvrtlnhrdgesspaeysvsltradmieftmeh
Timeline for d2fa1a1: