![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.252: CheC-like [103038] (1 superfamily) duplication: tandem repeat of two intertwined alpha-beta-(X)-beta(2) motifs |
![]() | Superfamily d.252.1: CheC-like [103039] (1 family) ![]() |
![]() | Family d.252.1.1: CheC-like [103040] (3 proteins) Pfam PF04509 |
![]() | Protein automated matches [190285] (1 species) not a true protein |
![]() | Species Thermotoga maritima [TaxId:243274] [187088] (1 PDB entry) |
![]() | Domain d2f9zb_: 2f9z B: [133181] Other proteins in same PDB: d2f9zc1, d2f9zc2, d2f9zd2, d2f9zd3 automated match to d1xkra_ |
PDB Entry: 2f9z (more details), 2.4 Å
SCOPe Domain Sequences for d2f9zb_:
Sequence, based on SEQRES records: (download)
>d2f9zb_ d.252.1.1 (B:) automated matches {Thermotoga maritima [TaxId: 243274]} mkiserqkdllkeignigagnaataisyminkkveisvpnveivpiskvifiakdpeeiv vgvkmpvtgdiegsvllimgttvvkkileiltgrapdnllnldefsasalreignimcgt yvsaladflgfkidtlppqlvidmisaifaeasieelednsedqivfvetllkveeeeep ltsymmmipkpgylvkifermgi
>d2f9zb_ d.252.1.1 (B:) automated matches {Thermotoga maritima [TaxId: 243274]} mkiserqkdllkeignigagnaataisyminkkveisvpnveivpiskvifiakdpeeiv vgvkmpvtgdiegsvllimgttvvkkileiltgrapdnllnldefsasalreignimcgt yvsaladflgfkidtlppqlvidmisaifaeasidqivfvetllkvpltsymmmipkpgy lvkifermgi
Timeline for d2f9zb_: