Lineage for d2f9za_ (2f9z A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008848Fold d.252: CheC-like [103038] (1 superfamily)
    duplication: tandem repeat of two intertwined alpha-beta-(X)-beta(2) motifs
  4. 3008849Superfamily d.252.1: CheC-like [103039] (1 family) (S)
  5. 3008850Family d.252.1.1: CheC-like [103040] (3 proteins)
    Pfam PF04509
  6. 3008860Protein automated matches [190285] (1 species)
    not a true protein
  7. 3008861Species Thermotoga maritima [TaxId:243274] [187088] (1 PDB entry)
  8. 3008862Domain d2f9za_: 2f9z A: [133180]
    Other proteins in same PDB: d2f9zc1, d2f9zc2, d2f9zd2, d2f9zd3
    automated match to d1xkra_

Details for d2f9za_

PDB Entry: 2f9z (more details), 2.4 Å

PDB Description: complex between the chemotaxis deamidase ched and the chemotaxis phosphatase chec from thermotoga maritima
PDB Compounds: (A:) chemotaxis protein CheC

SCOPe Domain Sequences for d2f9za_:

Sequence, based on SEQRES records: (download)

>d2f9za_ d.252.1.1 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
iserqkdllkeignigagnaataisyminkkveisvpnveivpiskvifiakdpeeivvg
vkmpvtgdiegsvllimgttvvkkileiltgrapdnllnldefsasalreignimcgtyv
saladflgfkidtlppqlvidmisaifaeasieelednsedqivfvetllkveeeeeplt
symmmipkpgylvkifermgi

Sequence, based on observed residues (ATOM records): (download)

>d2f9za_ d.252.1.1 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
iserqkdllkeignigagnaataisyminkkveisvpnveivpiskvifiakdpeeivvg
vkmpvtgdiegsvllimgttvvkkileiltgllnldefsasalreignimcgtyvsalad
flgfkidtlppqlvidmisaifaeasieelednsedqivfvetllkveepltsymmmipk
pgylvkifermgi

SCOPe Domain Coordinates for d2f9za_:

Click to download the PDB-style file with coordinates for d2f9za_.
(The format of our PDB-style files is described here.)

Timeline for d2f9za_: