Lineage for d2f9yb1 (2f9y B:23-285)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2099797Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (7 protein domains)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 2099847Protein Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD [142014] (1 species)
  7. 2099848Species Escherichia coli [TaxId:562] [142015] (1 PDB entry)
    Uniprot P0A9Q6 23-285
  8. 2099849Domain d2f9yb1: 2f9y B:23-285 [133179]
    Other proteins in same PDB: d2f9ya1
    complexed with zn

Details for d2f9yb1

PDB Entry: 2f9y (more details), 3.2 Å

PDB Description: the crystal structure of the carboxyltransferase subunit of acc from escherichia coli
PDB Compounds: (B:) acetyl-coenzyme A carboxylase carboxyl transferase subunit beta

SCOPe Domain Sequences for d2f9yb1:

Sequence, based on SEQRES records: (download)

>d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]}
vwtkcdscgqvlyraelernlevcpkcdhhmrmtarnrlhslldegslvelgselepkdv
lkfrdskkykdrlasaqketgekdalvvmkgtlygmpvvaaafefafmggsmgsvvgarf
vraveqaledncplicfsasggarmqealmslmqmaktsaalakmqerglpyisvltdpt
mggvsasfamlgdlniaepkaligfagprvieqtvreklppgfqrsefliekgaidmivr
rpemrlklasilaklmnlpapnp

Sequence, based on observed residues (ATOM records): (download)

>d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]}
vwtkcdscgqvlyraelernlevcpkcdhhmrmtarnrlhslldegslvelgselepkdv
lkfrdskkykqketgekdalvvmkgtlygmpvvaaafefafmggsmgsvvgarfvraveq
aledncplicfsasggarmqealmslmqmaktsaalakmqerglpyisvltdptmggvsa
sfamlgdlniaepkaligfagprvieqtvreklppgfqrsefliekgaidmivrrpemrl
klasilaklmnlpapnp

SCOPe Domain Coordinates for d2f9yb1:

Click to download the PDB-style file with coordinates for d2f9yb1.
(The format of our PDB-style files is described here.)

Timeline for d2f9yb1: