Lineage for d2f9ya1 (2f9y A:4-319)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2099797Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (7 protein domains)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 2099844Protein Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, AccA [142012] (1 species)
  7. 2099845Species Escherichia coli [TaxId:562] [142013] (1 PDB entry)
    Uniprot P0ABD5 4-319
  8. 2099846Domain d2f9ya1: 2f9y A:4-319 [133178]
    Other proteins in same PDB: d2f9yb1
    complexed with zn

Details for d2f9ya1

PDB Entry: 2f9y (more details), 3.2 Å

PDB Description: the crystal structure of the carboxyltransferase subunit of acc from escherichia coli
PDB Compounds: (A:) Acetyl-CoA carboxylase, Carboxyltransferase alpha chain

SCOPe Domain Sequences for d2f9ya1:

Sequence, based on SEQRES records: (download)

>d2f9ya1 c.14.1.4 (A:4-319) Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, AccA {Escherichia coli [TaxId: 562]}
nfldfeqpiaeleakidsltagsrqdekldinideevhrlreksveltrkifadlgawqi
aqlarhpqrpytldyvrlafdefdelagdrayaddkaivggiarldgrpvmiighqkgre
tkekirrnfgmpapegyrkalrlmqmaerfkmpiitfidtpgaypgvgaeergqseaiar
nlremsrlgvpvvctvigeggsggalaigvgdkvnmlqystysvispegcasilwksadk
aplaaeamgiirprlkelklidsiipeplggahrnpeamaaslkaqlladladldvlste
dlknrryqrlmsygya

Sequence, based on observed residues (ATOM records): (download)

>d2f9ya1 c.14.1.4 (A:4-319) Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, AccA {Escherichia coli [TaxId: 562]}
nfldfeqpiaeleakidsdeevhrlreksveltrkifadlgawqiaqlarhpqrpytldy
vrlafdefdelagdrayaddkaivggiarldgrpvmiighqkgretkekirrnfgmpape
gyrkalrlmqmaerfkmpiitfidtpgaypgvgaeergqseaiarnlremsrlgvpvvct
vigeggsggalaigvgdkvnmlqystysvispegcasilwksadkaplaaeamgiirprl
kelklidsiipeplggahrnpeamaaslkaqlladladldvlstedlknrryqrlmsygy
a

SCOPe Domain Coordinates for d2f9ya1:

Click to download the PDB-style file with coordinates for d2f9ya1.
(The format of our PDB-style files is described here.)

Timeline for d2f9ya1: