SCOPe 2.08: Domain d2f9wb1: 2f9w B:115-248

Lineage for d2f9wb1 (2f9w B:115-248)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.13: CoaX-like [142484] (1 protein)
   Pfam PF03309; Bordetella pertussis Bvg accessory factor family, Baf

6. Protein Type III pantothenate kinase, CoaX [142485] (3 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [142487] (2 PDB entries)
   Uniprot Q9HWC1 1-114! Uniprot Q9HWC1 115-248

8. Domain d2f9wb1: 2f9w B:115-248 [133176]
   Other proteins in same PDB: d2f9wa3, d2f9wb3
   automated match to d2f9ta1
   complexed with edo, gol, pau

Details for d2f9wb1

PDB Entry: 2f9w, 1.9 Å

PDB Description: Structure of the type III CoaA from Pseudomonas aeruginosa

PDB Compounds: (B:) pantothenate kinase

SCOPe Domain Sequences for d2f9wb1:

Sequence; same for both SEQRES and ATOM records:

>d2f9wb1 c.55.1.13 (B:115-248) Type III pantothenate kinase, CoaX {Pseudomonas aeruginosa [TaxId: 287]}
kaclvidlgtavtsdlvaadgvhlggyicpgmtlmrsqlrthtrriryddaearralasl
qpgqataeavergcllmlrgfvreqyamacellgpdceifltggdaelvrdelagarimp
dlvfvglalacpie

Timeline for d2f9wb1:

• d2f9wb1 first appeared in SCOP 1.73
  
• d2f9wb1 appears in SCOPe 2.07