SCOPe 2.08: Domain d2f9sb_: 2f9s B:

Lineage for d2f9sb_ (2f9s B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein Thiol-disulfide oxidoreductase ResA [102455] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [102456] (8 PDB entries)

8. Domain d2f9sb_: 2f9s B: [133169]
   automated match to d1st9a_

Details for d2f9sb_

PDB Entry: 2f9s, 1.4 Å

PDB Description: 2nd Crystal Structure Of A Soluble Domain Of ResA In The Oxidised Form

PDB Compounds: (B:) Thiol-disulfide oxidoreductase resA

SCOPe Domain Sequences for d2f9sb_:

Sequence; same for both SEQRES and ATOM records:

>d2f9sb_ c.47.1.10 (B:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]}
sdapnfvledtngkrielsdlkgkgvflnfwgtwcepckkefpymanqykhfksqgveiv
avnvgeskiavhnfmksygvnfpvvldtdrqvldaydvsplpttflinpegkvvkvvtgt
mtesmihdymnlikpg

Timeline for d2f9sb_:

• d2f9sb_ first appeared in SCOP 1.73, called d2f9sb1
  
• d2f9sb_ appears in SCOPe 2.07