SCOPe 2.02: Domain d2f9jb1: 2f9j B:12-125

Lineage for d2f9jb1 (2f9j B:12-125)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein Pre-mRNA branch site protein p14 [143316] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [143317] (2 PDB entries)
   Uniprot Q9Y3B4 12-125

8. Domain d2f9jb1: 2f9j B:12-125 [133165]
   automatically matched to 2F9J A:12-125
   mutant

Details for d2f9jb1

PDB Entry: 2f9j, 3 Å

PDB Description: 3.0 angstrom resolution structure of a y22m mutant of the spliceosomal protein p14 bound to a region of sf3b155

PDB Compounds: (B:) Pre-mRNA branch site protein p14

SCOPe Domain Sequences for d2f9jb1:

Sequence; same for both SEQRES and ATOM records:

>d2f9jb1 d.58.7.1 (B:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]}
rlppevnrilmirnlpykitaeemydifgkygpirqirvgntpetrgtayvvyedifdak
nacdhlsgfnvcnrylvvlyynanrafqkmdtkkkeeqlkllkekygintdppk

Timeline for d2f9jb1:

• d2f9jb1 first appeared in SCOP 1.73
  
• d2f9jb1 appears in SCOPe 2.01
  
• d2f9jb1 appears in SCOPe 2.03
  
• d2f9jb1 appears in the current release, SCOPe 2.08, called d2f9jb_