![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein Pre-mRNA branch site protein p14 [143316] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [143317] (2 PDB entries) Uniprot Q9Y3B4 12-125 |
![]() | Domain d2f9jb_: 2f9j B: [133165] automated match to d3lqvb_ mutant has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2f9j (more details), 3 Å
SCOPe Domain Sequences for d2f9jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f9jb_ d.58.7.1 (B:) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} rlppevnrilmirnlpykitaeemydifgkygpirqirvgntpetrgtayvvyedifdak nacdhlsgfnvcnrylvvlyynanrafqkmdtkkkeeqlkllkekygintdppk
Timeline for d2f9jb_: