Lineage for d2f9jb_ (2f9j B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952083Protein Pre-mRNA branch site protein p14 [143316] (1 species)
  7. 2952084Species Human (Homo sapiens) [TaxId:9606] [143317] (2 PDB entries)
    Uniprot Q9Y3B4 12-125
  8. 2952088Domain d2f9jb_: 2f9j B: [133165]
    automated match to d3lqvb_
    mutant

    has additional insertions and/or extensions that are not grouped together

Details for d2f9jb_

PDB Entry: 2f9j (more details), 3 Å

PDB Description: 3.0 angstrom resolution structure of a y22m mutant of the spliceosomal protein p14 bound to a region of sf3b155
PDB Compounds: (B:) Pre-mRNA branch site protein p14

SCOPe Domain Sequences for d2f9jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f9jb_ d.58.7.1 (B:) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]}
rlppevnrilmirnlpykitaeemydifgkygpirqirvgntpetrgtayvvyedifdak
nacdhlsgfnvcnrylvvlyynanrafqkmdtkkkeeqlkllkekygintdppk

SCOPe Domain Coordinates for d2f9jb_:

Click to download the PDB-style file with coordinates for d2f9jb_.
(The format of our PDB-style files is described here.)

Timeline for d2f9jb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2f9ja1