Lineage for d2f9ja1 (2f9j A:12-125)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1205320Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1205321Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1205528Protein Pre-mRNA branch site protein p14 [143316] (1 species)
  7. 1205529Species Human (Homo sapiens) [TaxId:9606] [143317] (2 PDB entries)
    Uniprot Q9Y3B4 12-125
  8. 1205532Domain d2f9ja1: 2f9j A:12-125 [133164]
    complex with peptide from Splicing factor 3B subunit 1 (Uniprot O75533 381-415), chains P and Q
    mutant

Details for d2f9ja1

PDB Entry: 2f9j (more details), 3 Å

PDB Description: 3.0 angstrom resolution structure of a y22m mutant of the spliceosomal protein p14 bound to a region of sf3b155
PDB Compounds: (A:) Pre-mRNA branch site protein p14

SCOPe Domain Sequences for d2f9ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f9ja1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]}
rlppevnrilmirnlpykitaeemydifgkygpirqirvgntpetrgtayvvyedifdak
nacdhlsgfnvcnrylvvlyynanrafqkmdtkkkeeqlkllkekygintdppk

SCOPe Domain Coordinates for d2f9ja1:

Click to download the PDB-style file with coordinates for d2f9ja1.
(The format of our PDB-style files is described here.)

Timeline for d2f9ja1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2f9jb1