SCOPe 2.08: Domain d2f9ja1: 2f9j A:12-125

Lineage for d2f9ja1 (2f9j A:12-125)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (70 proteins)
   Pfam PF00076
   Pfam PF13893

6. Protein Pre-mRNA branch site protein p14 [143316] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [143317] (2 PDB entries)
   Uniprot Q9Y3B4 12-125

8. Domain d2f9ja1: 2f9j A:12-125 [133164]
   complex with peptide from Splicing factor 3B subunit 1 (Uniprot O75533 381-415), chains P and Q
   mutant
   has additional insertions and/or extensions that are not grouped together

Details for d2f9ja1

PDB Entry: 2f9j, 3 Å

PDB Description: 3.0 angstrom resolution structure of a y22m mutant of the spliceosomal protein p14 bound to a region of sf3b155

PDB Compounds: (A:) Pre-mRNA branch site protein p14

SCOPe Domain Sequences for d2f9ja1:

Sequence; same for both SEQRES and ATOM records:

>d2f9ja1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]}
rlppevnrilmirnlpykitaeemydifgkygpirqirvgntpetrgtayvvyedifdak
nacdhlsgfnvcnrylvvlyynanrafqkmdtkkkeeqlkllkekygintdppk

Timeline for d2f9ja1:

• d2f9ja1 first appeared in SCOP 1.73
  
• d2f9ja1 appears in SCOPe 2.07