Lineage for d2f9hb_ (2f9h B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1815006Fold b.161: PTSIIA/GutA-like [141529] (1 superfamily)
    barrel, closed; n=8, S=12; mixed sheet; two overside connections; duplication: consists of two intertwinned structural repeats
  4. 1815007Superfamily b.161.1: PTSIIA/GutA-like [141530] (1 family) (S)
    automatically mapped to Pfam PF03829
  5. 1815008Family b.161.1.1: PTSIIA/GutA-like [141531] (2 proteins)
    Pfam PF03829
  6. 1815012Protein automated matches [190636] (1 species)
    not a true protein
  7. 1815013Species Enterococcus faecalis [TaxId:226185] [187692] (1 PDB entry)
  8. 1815014Domain d2f9hb_: 2f9h B: [133163]
    Other proteins in same PDB: d2f9ha1
    automated match to d2f9ha1

Details for d2f9hb_

PDB Entry: 2f9h (more details), 1.57 Å

PDB Description: The Crystal Structure of PTS System IIA Component from Enterococcus faecalis V583
PDB Compounds: (B:) PTS system, IIA component

SCOPe Domain Sequences for d2f9hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f9hb_ b.161.1.1 (B:) automated matches {Enterococcus faecalis [TaxId: 226185]}
mqatvteigkhaiddsekmiilfgetatdtlkqhaviqsfpekdqvtlaegdhlkigdtn
ytitkvgsfansnlqsiahstlifadaptdeddvirngvyltphqlpkitigttidylv

SCOPe Domain Coordinates for d2f9hb_:

Click to download the PDB-style file with coordinates for d2f9hb_.
(The format of our PDB-style files is described here.)

Timeline for d2f9hb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2f9ha1