Class b: All beta proteins [48724] (174 folds) |
Fold b.161: PTSIIA/GutA-like [141529] (1 superfamily) barrel, closed; n=8, S=12; mixed sheet; two overside connections; duplication: consists of two intertwinned structural repeats |
Superfamily b.161.1: PTSIIA/GutA-like [141530] (1 family) |
Family b.161.1.1: PTSIIA/GutA-like [141531] (2 proteins) Pfam PF03829 |
Protein automated matches [190636] (1 species) not a true protein |
Species Enterococcus faecalis [TaxId:226185] [187692] (1 PDB entry) |
Domain d2f9hb_: 2f9h B: [133163] Other proteins in same PDB: d2f9ha1 automated match to d2f9ha1 |
PDB Entry: 2f9h (more details), 1.57 Å
SCOPe Domain Sequences for d2f9hb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f9hb_ b.161.1.1 (B:) automated matches {Enterococcus faecalis [TaxId: 226185]} mqatvteigkhaiddsekmiilfgetatdtlkqhaviqsfpekdqvtlaegdhlkigdtn ytitkvgsfansnlqsiahstlifadaptdeddvirngvyltphqlpkitigttidylv
Timeline for d2f9hb_: