![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.161: PTSIIA/GutA-like [141529] (1 superfamily) barrel, closed; n=8, S=12; mixed sheet; two overside connections; duplication: consists of two intertwinned structural repeats |
![]() | Superfamily b.161.1: PTSIIA/GutA-like [141530] (1 family) ![]() |
![]() | Family b.161.1.1: PTSIIA/GutA-like [141531] (2 proteins) Pfam PF03829 |
![]() | Protein PTS system, IIa component (PTSIIA) [141532] (1 species) |
![]() | Species Enterococcus faecalis [TaxId:1351] [141533] (1 PDB entry) Uniprot Q831B0 3-123 EF2603 |
![]() | Domain d2f9ha1: 2f9h A:3-123 [133162] Other proteins in same PDB: d2f9hb_ |
PDB Entry: 2f9h (more details), 1.57 Å
SCOPe Domain Sequences for d2f9ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f9ha1 b.161.1.1 (A:3-123) PTS system, IIa component (PTSIIA) {Enterococcus faecalis [TaxId: 1351]} wkmqatvteigkhaiddsekmiilfgetatdtlkqhaviqsfpekdqvtlaegdhlkigd tnytitkvgsfansnlqsiahstlifadaptdeddvirngvyltphqlpkitigttidyl v
Timeline for d2f9ha1: