Lineage for d2f9fa1 (2f9f A:2-167)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910507Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2910508Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2910940Family c.87.1.8: Glycosyl transferases group 1 [110734] (4 proteins)
    Pfam PF00534
  6. 2910941Protein First mannosyl transferase WbaZ [142769] (1 species)
  7. 2910942Species Archaeoglobus fulgidus [TaxId:2234] [142770] (1 PDB entry)
    Uniprot O30192 173-338
  8. 2910943Domain d2f9fa1: 2f9f A:2-167 [133161]
    C-terminal domain only
    fragment; missing more than one-third of the common structure and/or sequence

Details for d2f9fa1

PDB Entry: 2f9f (more details), 1.8 Å

PDB Description: crystal structure of the putative mannosyl transferase (wbaz-1)from archaeoglobus fulgidus, northeast structural genomics target gr29a.
PDB Compounds: (A:) first mannosyl transferase (wbaZ-1)

SCOPe Domain Sequences for d2f9fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f9fa1 c.87.1.8 (A:2-167) First mannosyl transferase WbaZ {Archaeoglobus fulgidus [TaxId: 2234]}
vetskfkfkcygdfwlsvnriypekrielqlevfkklqdeklyivgwfskgdhaeryark
imkiapdnvkflgsvseeelidlysrckgllctakdedfgltpieamasgkpviavnegg
fketvinektgylvnadvneiidamkkvsknpdkfkkdcfrrakef

SCOPe Domain Coordinates for d2f9fa1:

Click to download the PDB-style file with coordinates for d2f9fa1.
(The format of our PDB-style files is described here.)

Timeline for d2f9fa1: