SCOPe 2.05: Domain d2f9db_: 2f9d B:

Lineage for d2f9db_ (2f9d B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein Pre-mRNA branch site protein p14 [143316] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [143317] (2 PDB entries)
   Uniprot Q9Y3B4 12-125

8. Domain d2f9db_: 2f9d B: [133160]
   automated match to d2f9da1

Details for d2f9db_

PDB Entry: 2f9d, 2.5 Å

PDB Description: 2.5 angstrom resolution structure of the spliceosomal protein p14 bound to region of sf3b155

PDB Compounds: (B:) Pre-mRNA branch site protein p14

SCOPe Domain Sequences for d2f9db_:

Sequence; same for both SEQRES and ATOM records:

>d2f9db_ d.58.7.1 (B:) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]}
rlppevnrilyirnlpykitaeemydifgkygpirqirvgntpetrgtayvvyedifdak
nacdhlsgfnvcnrylvvlyynanrafqkmdtkkkeeqlkllkekygintdppk

Timeline for d2f9db_:

• d2f9db_ first appeared in SCOP 1.73, called d2f9db1
  
• d2f9db_ appears in SCOPe 2.04
  
• d2f9db_ appears in SCOPe 2.06
  
• d2f9db_ appears in the current release, SCOPe 2.08