SCOP 1.73: Domain d2f9da1: 2f9d A:12-125

Lineage for d2f9da1 (2f9d A:12-125)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families)

5. Family d.58.7.1: Canonical RBD [54929] (67 proteins)

6. Protein Pre-mRNA branch site protein p14 [143316] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [143317] (2 PDB entries)

8. Domain d2f9da1: 2f9d A:12-125 [133159]
   complex with peptide from Splicing factor 3B subunit 1 (SQ O75533 373-415), chains P and Q

Details for d2f9da1

PDB Entry: 2f9d, 2.5 Å

PDB Description: 2.5 angstrom resolution structure of the spliceosomal protein p14 bound to region of sf3b155

PDB Compounds: (A:) Pre-mRNA branch site protein p14

SCOP Domain Sequences for d2f9da1:

Sequence; same for both SEQRES and ATOM records:

>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]}
rlppevnrilyirnlpykitaeemydifgkygpirqirvgntpetrgtayvvyedifdak
nacdhlsgfnvcnrylvvlyynanrafqkmdtkkkeeqlkllkekygintdppk

Timeline for d2f9da1:

• d2f9da1 is new in SCOP 1.73
  
• d2f9da1 appears in SCOP 1.75
  
• d2f9da1 appears in the current release, SCOPe 2.08