Lineage for d2f9da1 (2f9d A:12-125)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952083Protein Pre-mRNA branch site protein p14 [143316] (1 species)
  7. 2952084Species Human (Homo sapiens) [TaxId:9606] [143317] (2 PDB entries)
    Uniprot Q9Y3B4 12-125
  8. 2952085Domain d2f9da1: 2f9d A:12-125 [133159]
    Other proteins in same PDB: d2f9dp_, d2f9dq_
    complex with peptide from Splicing factor 3B subunit 1 (Uniprot O75533 373-415), chains P and Q
    has additional insertions and/or extensions that are not grouped together

Details for d2f9da1

PDB Entry: 2f9d (more details), 2.5 Å

PDB Description: 2.5 angstrom resolution structure of the spliceosomal protein p14 bound to region of sf3b155
PDB Compounds: (A:) Pre-mRNA branch site protein p14

SCOPe Domain Sequences for d2f9da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]}
rlppevnrilyirnlpykitaeemydifgkygpirqirvgntpetrgtayvvyedifdak
nacdhlsgfnvcnrylvvlyynanrafqkmdtkkkeeqlkllkekygintdppk

SCOPe Domain Coordinates for d2f9da1:

Click to download the PDB-style file with coordinates for d2f9da1.
(The format of our PDB-style files is described here.)

Timeline for d2f9da1: