Lineage for d2f9ca1 (2f9c A:3-322)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 809516Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 809517Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (8 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 809692Family b.81.1.7: YdcK-like [141583] (1 protein)
    part of Pfam PF00132
    this is a repeat family; one repeat unit is 2f9c A:267-285 found in domain
  6. 809693Protein Hypothetical protein YdcK [141584] (1 species)
  7. 809694Species Salmonella enterica [TaxId:28901] [141585] (1 PDB entry)
    Uniprot Q5PHU6 3-322
  8. 809695Domain d2f9ca1: 2f9c A:3-322 [133158]
    complexed with cs

Details for d2f9ca1

PDB Entry: 2f9c (more details), 2.8 Å

PDB Description: Crystal structure of YDCK from Salmonella cholerae. NESG target SCR6
PDB Compounds: (A:) Hypothetical protein YDCK

SCOP Domain Sequences for d2f9ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]}
kyrlsegpraftyqvdgekksvllrqviavtdfndvkagtsggwvdadnvlsqqgdcwiy
denamafagteitgnaritqpctlynnvrigdnvwidradisdgarisdnvtiqsssvre
ecaiygdarvlnqseilaiqglthehaqilqiydratvnhsrivhqvqlygnatithafi
ehraevfdfaliegdkdnnvwicdcakvygharviagteedaiptlryssqvaehalieg
ncvlkhhvlvgghaevrggpillddrvlieghaciqgeilierqveisgraaviafddnt
ihlrgpkvingedritrtpl

SCOP Domain Coordinates for d2f9ca1:

Click to download the PDB-style file with coordinates for d2f9ca1.
(The format of our PDB-style files is described here.)

Timeline for d2f9ca1: