SCOPe 2.07: Domain d2f96b_: 2f96 B:

Lineage for d2f96b_ (2f96 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
   contains Pfam PF00929

6. Protein Ribonuclease T [142497] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [142498] (1 PDB entry)
   Uniprot Q9HY82 19-220

8. Domain d2f96b_: 2f96 B: [133154]
   automated match to d2f96a1
   complexed with mg

Details for d2f96b_

PDB Entry: 2f96, 2.09 Å

PDB Description: 2.1 a crystal structure of pseudomonas aeruginosa rnase t (ribonuclease t)

PDB Compounds: (B:) Ribonuclease T

SCOPe Domain Sequences for d2f96b_:

Sequence; same for both SEQRES and ATOM records:

>d2f96b_ c.55.3.5 (B:) Ribonuclease T {Pseudomonas aeruginosa [TaxId: 287]}
rhpmarrfrgylpvvvdvetggfnsatdalleiaattvgmdekgflfpehtyffriepfe
ganiepaaleftgikldhplrmavqeeaalteifrgirkalkangckrailvghnssfdl
gflnaavartgikrnpfhpfssfdtatlaglaygqtvlakacqaagmefdnreahsaryd
tektaelfcgivnrwkemggwm

Timeline for d2f96b_:

• d2f96b_ first appeared in SCOP 1.73, called d2f96b1
  
• d2f96b_ appears in SCOPe 2.06
  
• d2f96b_ appears in the current release, SCOPe 2.08