Lineage for d2f96b_ (2f96 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886484Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
    contains Pfam PF00929
  6. 2886845Protein Ribonuclease T [142497] (1 species)
  7. 2886846Species Pseudomonas aeruginosa [TaxId:287] [142498] (1 PDB entry)
    Uniprot Q9HY82 19-220
  8. 2886848Domain d2f96b_: 2f96 B: [133154]
    automated match to d2f96a1
    complexed with mg

Details for d2f96b_

PDB Entry: 2f96 (more details), 2.09 Å

PDB Description: 2.1 a crystal structure of pseudomonas aeruginosa rnase t (ribonuclease t)
PDB Compounds: (B:) Ribonuclease T

SCOPe Domain Sequences for d2f96b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f96b_ c.55.3.5 (B:) Ribonuclease T {Pseudomonas aeruginosa [TaxId: 287]}
rhpmarrfrgylpvvvdvetggfnsatdalleiaattvgmdekgflfpehtyffriepfe
ganiepaaleftgikldhplrmavqeeaalteifrgirkalkangckrailvghnssfdl
gflnaavartgikrnpfhpfssfdtatlaglaygqtvlakacqaagmefdnreahsaryd
tektaelfcgivnrwkemggwm

SCOPe Domain Coordinates for d2f96b_:

Click to download the PDB-style file with coordinates for d2f96b_.
(The format of our PDB-style files is described here.)

Timeline for d2f96b_: