SCOP 1.73: Domain d2f96a1: 2f96 A:19-220

Lineage for d2f96a1 (2f96 A:19-220)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (12 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (14 proteins)
   contains Pfam PF00929

6. Protein Ribonuclease T [142497] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [142498] (1 PDB entry)

8. Domain d2f96a1: 2f96 A:19-220 [133153]
   complexed with mg

Details for d2f96a1

PDB Entry: 2f96, 2.09 Å

PDB Description: 2.1 a crystal structure of pseudomonas aeruginosa rnase t (ribonuclease t)

PDB Compounds: (A:) Ribonuclease T

SCOP Domain Sequences for d2f96a1:

Sequence; same for both SEQRES and ATOM records:

>d2f96a1 c.55.3.5 (A:19-220) Ribonuclease T {Pseudomonas aeruginosa [TaxId: 287]}
rhpmarrfrgylpvvvdvetggfnsatdalleiaattvgmdekgflfpehtyffriepfe
ganiepaaleftgikldhplrmavqeeaalteifrgirkalkangckrailvghnssfdl
gflnaavartgikrnpfhpfssfdtatlaglaygqtvlakacqaagmefdnreahsaryd
tektaelfcgivnrwkemggwm

Timeline for d2f96a1:

• d2f96a1 is new in SCOP 1.73
  
• d2f96a1 appears in SCOP 1.75
  
• d2f96a1 appears in the current release, SCOPe 2.08