Lineage for d2f93a_ (2f93 A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2628564Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 2628565Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 2628566Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins)
  6. 2628733Protein Sensory rhodopsin II [64526] (1 species)
  7. 2628734Species Natronobacterium pharaonis [TaxId:2257] [64527] (14 PDB entries)
  8. 2628737Domain d2f93a_: 2f93 A: [133151]
    Other proteins in same PDB: d2f93b1
    automated match to d1h2sa_
    complexed with bog, ret

Details for d2f93a_

PDB Entry: 2f93 (more details), 2 Å

PDB Description: k intermediate structure of sensory rhodopsin ii/transducer complex in combination with the ground state structure
PDB Compounds: (A:) sensory rhodopsin II

SCOPe Domain Sequences for d2f93a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f93a_ f.13.1.1 (A:) Sensory rhodopsin II {Natronobacterium pharaonis [TaxId: 2257]}
glttlfwlgaigmlvgtlafawagrdagsgerryyvtlvgisgiaavayvvmalgvgwvp
vaertvfapryidwilttplivyflgllagldsrefgivitlntvvmlagfagamvpgie
ryalfgmgavaflglvyylvgpmtesasqrssgikslyvrlrnltvilwaiypfiwllgp
pgvalltptvdvalivyldlvtkvgfgfialdaaatlrae

SCOPe Domain Coordinates for d2f93a_:

Click to download the PDB-style file with coordinates for d2f93a_.
(The format of our PDB-style files is described here.)

Timeline for d2f93a_: