SCOPe 2.08: Domain d2f93a_: 2f93 A:

Lineage for d2f93a_ (2f93 A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families)
   Pfam PF13853. Phylogeny described in PubMed 12761335

5. Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins)

6. Protein Sensory rhodopsin II [64526] (1 species)

7. Species Natronobacterium pharaonis [TaxId:2257] [64527] (14 PDB entries)

8. Domain d2f93a_: 2f93 A: [133151]
   Other proteins in same PDB: d2f93b1
   automated match to d1h2sa_
   complexed with bog, ret

Details for d2f93a_

PDB Entry: 2f93, 2 Å

PDB Description: k intermediate structure of sensory rhodopsin ii/transducer complex in combination with the ground state structure

PDB Compounds: (A:) sensory rhodopsin II

SCOPe Domain Sequences for d2f93a_:

Sequence; same for both SEQRES and ATOM records:

>d2f93a_ f.13.1.1 (A:) Sensory rhodopsin II {Natronobacterium pharaonis [TaxId: 2257]}
glttlfwlgaigmlvgtlafawagrdagsgerryyvtlvgisgiaavayvvmalgvgwvp
vaertvfapryidwilttplivyflgllagldsrefgivitlntvvmlagfagamvpgie
ryalfgmgavaflglvyylvgpmtesasqrssgikslyvrlrnltvilwaiypfiwllgp
pgvalltptvdvalivyldlvtkvgfgfialdaaatlrae

Timeline for d2f93a_:

• d2f93a_ first appeared in SCOP 1.73, called d2f93a1
  
• d2f93a_ appears in SCOPe 2.07