SCOPe 2.07: Domain d2f90b_: 2f90 B:

Lineage for d2f90b_ (2f90 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families)

5. Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)

6. Protein automated matches [190196] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186938] (20 PDB entries)

8. Domain d2f90b_: 2f90 B: [133149]
   automated match to d1t8pa_
   complexed with 3pg, alf

Details for d2f90b_

PDB Entry: 2f90, 2 Å

PDB Description: Crystal structure of bisphosphoglycerate mutase in complex with 3-phosphoglycerate and AlF4-

PDB Compounds: (B:) Bisphosphoglycerate mutase

SCOPe Domain Sequences for d2f90b_:

Sequence; same for both SEQRES and ATOM records:

>d2f90b_ c.60.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kyklimlrhgegawnkenrfcswvdqklnsegmeearncgkqlkalnfefdlvftsvlnr
sihtawlileelgqewvpvesswrlnerhygaliglnreqmalnhgeeqvrlwrrsynvt
pppieeshpyyqeiyndrrykvcdvpldqlprseslkdvlerllpywneriapevlrgkt
ilisahgnssrallkhlegisdediinitlptgvpilleldenlravgphqflgdqeaiq
aaikkvedqgkvk

Timeline for d2f90b_:

• d2f90b_ first appeared in SCOP 1.73, called d2f90b1
  
• d2f90b_ appears in SCOPe 2.06
  
• d2f90b_ appears in the current release, SCOPe 2.08