Lineage for d2f8tb1 (2f8t B:4-314)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 947586Superfamily b.34.14: PAZ domain [101690] (1 family) (S)
  5. 947587Family b.34.14.1: PAZ domain [101691] (6 proteins)
  6. 947599Protein Argonaute homologue Aq_1447 [141227] (1 species)
    includes the N-terminal domain
  7. 947600Species Aquifex aeolicus [TaxId:63363] [141228] (4 PDB entries)
    Uniprot O67434 4-314
  8. 947605Domain d2f8tb1: 2f8t B:4-314 [133146]
    Other proteins in same PDB: d2f8ta2, d2f8tb2
    automatically matched to 1YVU A:4-314
    protein/RNA complex

Details for d2f8tb1

PDB Entry: 2f8t (more details), 3.1 Å

PDB Description: Crystal structure of Aa-Ago with externally-bound siRNA
PDB Compounds: (B:) Argonaute protein

SCOPe Domain Sequences for d2f8tb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f8tb1 b.34.14.1 (B:4-314) Argonaute homologue Aq_1447 {Aquifex aeolicus [TaxId: 63363]}
eallnlyrieyrpkdttftvfkptheiqkeklnkvrwrvflqtglptfrredefwcagkv
ekdtlyltlsngeivelkrvgeeefrgfqnerecqelfrdfltktkvkdkfisdfykkfr
dkitvqgknrkialipevnekvlkseegyfllhldlkfriqpfetlqtllerndfnpkri
rvkpigidfvgrvqdvfkakekgeeffrlcmersthksskkaweellknrelrekaflvv
lekgytypatilkpvltyenledeernevadivrmepgkrlnliryilrryvkalrdygw
yispeeerakg

SCOPe Domain Coordinates for d2f8tb1:

Click to download the PDB-style file with coordinates for d2f8tb1.
(The format of our PDB-style files is described here.)

Timeline for d2f8tb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f8tb2