Lineage for d2f8ta2 (2f8t A:315-706)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701966Superfamily c.55.3: Ribonuclease H-like [53098] (12 families) (S)
    consists of one domain of this fold
  5. 702473Family c.55.3.10: PIWI domain [110640] (3 proteins)
    Pfam PF02171
  6. 702474Protein Argonaute homologue Aq_1447 [142501] (1 species)
    includes the middle domain
  7. 702475Species Aquifex aeolicus [TaxId:63363] [142502] (4 PDB entries)
  8. 702479Domain d2f8ta2: 2f8t A:315-706 [133145]
    Other proteins in same PDB: d2f8ta1, d2f8tb1
    automatically matched to 1YVU A:315-706

Details for d2f8ta2

PDB Entry: 2f8t (more details), 3.1 Å

PDB Description: Crystal structure of Aa-Ago with externally-bound siRNA
PDB Compounds: (A:) Argonaute protein

SCOP Domain Sequences for d2f8ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f8ta2 c.55.3.10 (A:315-706) Argonaute homologue Aq_1447 {Aquifex aeolicus [TaxId: 63363]}
klnfkdtvldakgkntkvitnlrkflelcrpfvkkdvlsveiisvsvykklewrkeeflk
elinflknkgiklkikgkslilaqtreeakeklipvinkikdvdlvivfleeypkvdpyk
sfllydfvkrellkkmipsqvilnrtlknenlkfvllnvaeqvlaktgnipyklkeiegk
vdafvgidisritrdgktvnavaftkifnskgelvryyltsypafgekltekaigdvfsl
leklgfkkgskivvhrdgrlyrdevaafkkygelygyslelleiikrnnprffsnekfik
gyfyklsedsvilatynqvyegthqpikvrkvygelpvevlcsqilsltlmnyssfqpik
lpatvhysdkitklmlrgiepikkegdimywl

SCOP Domain Coordinates for d2f8ta2:

Click to download the PDB-style file with coordinates for d2f8ta2.
(The format of our PDB-style files is described here.)

Timeline for d2f8ta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f8ta1