Lineage for d2f8sb1 (2f8s B:4-314)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 797284Superfamily b.34.14: PAZ domain [101690] (1 family) (S)
  5. 797285Family b.34.14.1: PAZ domain [101691] (5 proteins)
  6. 797297Protein Argonaute homologue Aq_1447 [141227] (1 species)
    includes the N-terminal domain
  7. 797298Species Aquifex aeolicus [TaxId:63363] [141228] (4 PDB entries)
    Uniprot O67434 4-314
  8. 797301Domain d2f8sb1: 2f8s B:4-314 [133142]
    Other proteins in same PDB: d2f8sa2, d2f8sb2
    automatically matched to 1YVU A:4-314

Details for d2f8sb1

PDB Entry: 2f8s (more details), 3 Å

PDB Description: Crystal structure of Aa-Ago with externally-bound siRNA
PDB Compounds: (B:) Argonaute protein

SCOP Domain Sequences for d2f8sb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f8sb1 b.34.14.1 (B:4-314) Argonaute homologue Aq_1447 {Aquifex aeolicus [TaxId: 63363]}
eallnlyrieyrpkdttftvfkptheiqkeklnkvrwrvflqtglptfrredefwcagkv
ekdtlyltlsngeivelkrvgeeefrgfqnerecqelfrdfltktkvkdkfisdfykkfr
dkitvqgknrkialipevnekvlkseegyfllhldlkfriqpfetlqtllerndfnpkri
rvkpigidfvgrvqdvfkakekgeeffrlcmersthksskkaweellknrelrekaflvv
lekgytypatilkpvltyenledeernevadivrmepgkrlnliryilrryvkalrdygw
yispeeerakg

SCOP Domain Coordinates for d2f8sb1:

Click to download the PDB-style file with coordinates for d2f8sb1.
(The format of our PDB-style files is described here.)

Timeline for d2f8sb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f8sb2