Lineage for d2f8sa1 (2f8s A:3-314)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1785323Superfamily b.34.14: PAZ domain [101690] (1 family) (S)
  5. 1785324Family b.34.14.1: PAZ domain [101691] (6 proteins)
  6. 1785349Protein automated matches [191296] (2 species)
    not a true protein
  7. 1785350Species Aquifex aeolicus [TaxId:63363] [255166] (2 PDB entries)
  8. 1785351Domain d2f8sa1: 2f8s A:3-314 [133140]
    Other proteins in same PDB: d2f8sa2, d2f8sb2
    automated match to d1yvua1
    protein/RNA complex

Details for d2f8sa1

PDB Entry: 2f8s (more details), 3 Å

PDB Description: Crystal structure of Aa-Ago with externally-bound siRNA
PDB Compounds: (A:) Argonaute protein

SCOPe Domain Sequences for d2f8sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f8sa1 b.34.14.1 (A:3-314) automated matches {Aquifex aeolicus [TaxId: 63363]}
keallnlyrieyrpkdttftvfkptheiqkeklnkvrwrvflqtglptfrredefwcagk
vekdtlyltlsngeivelkrvgeeefrgfqnerecqelfrdfltktkvkdkfisdfykkf
rdkitvqgknrkialipevnekvlkseegyfllhldlkfriqpfetlqtllerndfnpkr
irvkpigidfvgrvqdvfkakekgeeffrlcmersthksskkaweellknrelrekaflv
vlekgytypatilkpvltyenledeernevadivrmepgkrlnliryilrryvkalrdyg
wyispeeerakg

SCOPe Domain Coordinates for d2f8sa1:

Click to download the PDB-style file with coordinates for d2f8sa1.
(The format of our PDB-style files is described here.)

Timeline for d2f8sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f8sa2