![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (18 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.14: PAZ domain [101690] (1 family) ![]() |
![]() | Family b.34.14.1: PAZ domain [101691] (5 proteins) |
![]() | Protein Argonaute homologue Aq_1447 [141227] (1 species) includes the N-terminal domain |
![]() | Species Aquifex aeolicus [TaxId:63363] [141228] (4 PDB entries) |
![]() | Domain d2f8sa1: 2f8s A:4-314 [133140] Other proteins in same PDB: d2f8sa2, d2f8sb2 automatically matched to 1YVU A:4-314 |
PDB Entry: 2f8s (more details), 3 Å
SCOP Domain Sequences for d2f8sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f8sa1 b.34.14.1 (A:4-314) Argonaute homologue Aq_1447 {Aquifex aeolicus [TaxId: 63363]} eallnlyrieyrpkdttftvfkptheiqkeklnkvrwrvflqtglptfrredefwcagkv ekdtlyltlsngeivelkrvgeeefrgfqnerecqelfrdfltktkvkdkfisdfykkfr dkitvqgknrkialipevnekvlkseegyfllhldlkfriqpfetlqtllerndfnpkri rvkpigidfvgrvqdvfkakekgeeffrlcmersthksskkaweellknrelrekaflvv lekgytypatilkpvltyenledeernevadivrmepgkrlnliryilrryvkalrdygw yispeeerakg
Timeline for d2f8sa1: