SCOP 1.73: Domain d2f8nh1: 2f8n H:1430-1522

Lineage for d2f8nh1 (2f8n H:1430-1522)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2B [47119] (5 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (23 PDB entries)

8. Domain d2f8nh1: 2f8n H:1430-1522 [133139]
   Other proteins in same PDB: d2f8na1, d2f8nb1, d2f8ne1, d2f8nf1, d2f8ng1
   automatically matched to d1s32d_

Details for d2f8nh1

PDB Entry: 2f8n, 2.9 Å

PDB Description: 2.9 Angstrom X-ray structure of hybrid macroH2A nucleosomes

PDB Compounds: (H:) Histone H2B.1

SCOP Domain Sequences for d2f8nh1:

Sequence; same for both SEQRES and ATOM records:

>d2f8nh1 a.22.1.1 (H:1430-1522) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]}
rkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstitsr
eiqtavrlllpgelakhavsegtkavtkytsak

Timeline for d2f8nh1:

• d2f8nh1 is new in SCOP 1.73
  
• d2f8nh1 appears in SCOP 1.75
  
• d2f8nh1 appears in the current release, SCOPe 2.08, called d2f8nh_