SCOPe 2.06: Domain d2f8ng_: 2f8n G:

Lineage for d2f8ng_ (2f8n G:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein macro-H2A.1, histone domain [140396] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140397] (2 PDB entries)
   Uniprot O75367 11-116

8. Domain d2f8ng_: 2f8n G: [133138]
   Other proteins in same PDB: d2f8na_, d2f8nb_, d2f8nd_, d2f8ne_, d2f8nf_, d2f8nh_, d2f8nk1
   automated match to d1u35c1
   protein/DNA complex

Details for d2f8ng_

PDB Entry: 2f8n, 2.9 Å

PDB Description: 2.9 Angstrom X-ray structure of hybrid macroH2A nucleosomes

PDB Compounds: (G:) Core histone macro-H2A.1

SCOPe Domain Sequences for d2f8ng_:

Sequence; same for both SEQRES and ATOM records:

>d2f8ng_ a.22.1.1 (G:) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]}
stktsrsakagvifpvgrmlryikkghpkyrigvgapvymaavleyltaeilelavnaar
dnkkgrvtprhillavandeelnqllkgvtiasggvlpnihpellakk

Timeline for d2f8ng_:

• d2f8ng_ first appeared in SCOP 1.73, called d2f8ng1
  
• d2f8ng_ appears in SCOPe 2.05
  
• d2f8ng_ appears in SCOPe 2.07
  
• d2f8ng_ appears in the current release, SCOPe 2.08